PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_005297-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB_related
Protein Properties Length: 336aa    MW: 36793.6 Da    PI: 9.3885
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_005297-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.23.7e-1364108147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT +E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  AHYPO_005297-RA  64 RESWTDQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 108
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.05E-1658114IPR009057Homeodomain-like
PROSITE profilePS5129415.01459113IPR017930Myb domain
TIGRFAMsTIGR015572.6E-1862111IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.4E-662114IPR009057Homeodomain-like
SMARTSM007171.4E-1063111IPR001005SANT/Myb domain
PfamPF002499.5E-1164108IPR001005SANT/Myb domain
CDDcd001675.61E-866109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MVSVNPNPTQ SGEFHLDFAS GMPLPGVNSL PSANSPVSGG GVGVPPMDDH YKKVRKPYTI  60
TKSRESWTDQ EHDKFLEALQ LFDRDWKKIE AFVGSKTVIQ IRSHAQKYFL KVQKSGSKER  120
VPPPRPKRKA AHPYPQKASK IAATINQPTG QYQSQPVGVL EPGYVYHHDP SSALSNQSVS  180
APTSSWTFGS MPAANSLNLR RDDAVLAMPS VTPNICCTSS NESGSTWPTA GTIDRTDHAK  240
RLKVMPDFAQ VYNFIGSVFD PNSSDHLQKL KTMDPINVET ALLLMRNLSV NLLSPEFEEH  300
RKLFSSYDAE SGKARSCSPL LPAPDNSKTA IPAVY*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00423DAPTransfer from AT4G01280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010669883.11e-174PREDICTED: protein REVEILLE 6-like isoform X1
SwissprotC0SVG51e-100RVE5_ARATH; Protein REVEILLE 5
TrEMBLA0A0K9QSI30.0A0A0K9QSI3_SPIOL; Uncharacterized protein
STRINGPOPTR_0014s08520.11e-129(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.25e-77MYB_related family protein